Q5TEZ4 CF164_HUMAN

Gene name: LINC01590
Protein name: Putative uncharacterized protein encoded by LINC01590

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P14735 IDE 0.78247 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
2 Q9NPR2 SEMA4B 0.69985 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
3 Q9NSP4 CENPM 0.67871
4 Q05932 FPGS 0.66251 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
5 Q5HYI7 MTX3 0.65604 membrane organization GO:0061024
protein transport GO:0015031
transport GO:0006810
6 O00478 BTN3A3 0.65128 immune system process GO:0002376
signal transduction GO:0007165
7 Q9H0E7 USP44 0.6241 catabolic process GO:0009056
cell cycle GO:0007049
cell division GO:0051301
...
8 P85298 ARHGAP8 0.62131 cellular protein modification process GO:0006464
signal transduction GO:0007165
9 Q7Z7M1 ADGRD2 0.61801 signal transduction GO:0007165
10 Q8IZ26 ZNF34 0.61397 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60    
AA:                      MSHLPAVSPVFFQLPAPHPPTVLRPQLGLHPNPECDREKMSVRDHDPEVLTRNSACKPRGQLSGHLLKPRAPLEAA
STMI:                                                                                                
DO_DISOPRED3:            DDD........................................................................D
DO_IUPRED2A:             .........DDD..DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................................................DDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                              PaPhPPtvlrPqlglhPnP                                           
RICH_[FP]:                         FFqlPaPhPPtvlrP                                                   
RICH_[HP]:                               PHPPtvlrPqlglHP                                             
RICH_[LP]:                            LPaPhPPtvLrPqLgLhPnP                                           
RICH_MOBI_[L]:                                                                        LsghLLkprapL