Q5TGI4 SAMD5_HUMAN
Gene name: SAMD5
Protein name: Sterile alpha motif domain-containing protein 5
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86U38 | NOP9 | 0.91537 | |
| 2 | P28329 | CHAT | 0.82369 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 transport GO:0006810 |
| 3 | Q6ZS46 | n/a | 0.78918 | |
| 4 | Q14681 | KCTD2 | 0.76403 | catabolic process GO:0009056 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 5 | Q504Y2 | PKDCC | 0.74744 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 6 | P79522 | PRR3 | 0.74327 | |
| 7 | P48634 | PRRC2A | 0.73372 | cell differentiation GO:0030154 |
| 8 | A6NIX2 | WTIP | 0.73203 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell morphogenesis GO:0000902 ... |
| 9 | Q12852 | MAP3K12 | 0.73065 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q5JR98 | TCTEX1D4 | 0.72988 |
20 40 60 80 100 AA: MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAAGLYFTLEPQPAPPGPPADAVPTGRRGEPCG STMI: DO_DISOPRED3: D......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .........................................................DD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: D................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[AP]: PAPPgPPAdA RICH_[G]: GrrGepcG RICH_[P]: PqPaPPgPPadavPtgrrgePcg RICH_[R]: RRgepcg RICH_[GP]: PPGPPadavPtGrrGePcG RICH_[GR]: GRRGepcG RICH_fLPS_[P]: ePqPaPPgPPadavPtgrrgeP RICH_fLPS_[G]: GrrGepcG RICH_fLPS_[GP]: PqPaPPGPPadavPtGrrGePcG RICH_MOBI_[AP]: PAPPgPPAdA RICH_MOBI_[G]: GrrGepcG RICH_MOBI_[P]: PqPaPPgPPadavPtgrrgePcg RICH_MOBI_[R]: RRgepcg RICH_MOBI_[GP]: PPGPPadavPtGrrGePcG RICH_MOBI_[GR]: GRRGepcG RICH_fLPS_MOBI_[P]: ePqPaPPgPPadavP RICH_fLPS_MOBI_[G]: GrrGepcG
120 140 160 AA: GPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................DDDDDD DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD.......................DDDD..D...................D.D DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD..............................................DDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDD..............................................DDDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDD...................................................... RICH_[G]: GpaqGtrGdsrG RICH_[P]: gP RICH_[R]: gpaqgtRgdsR RICH_[GP]: GPaqG RICH_[GR]: GpaqGtRGdsRG RICH_fLPS_[G]: GpaqGtrGdsrG RICH_fLPS_[GP]: GPaqGtrG RICH_MOBI_[G]: GpaqGtrGdsrG RICH_MOBI_[P]: gP RICH_MOBI_[R]: gpaqgtRgdsR RICH_MOBI_[GP]: GP RICH_MOBI_[GR]: GpaqGtRGdsRG RICH_fLPS_MOBI_[G]: GpaqGtrGdsrG