Q5TGS1 HES3_HUMAN

Gene name: HES3
Protein name: Transcription factor HES-3

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WX92 NELFB 0.71521 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q15735 INPP5J 0.68786 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
3 Q9H6K5 PRR36 0.67675
4 Q3MIN7 RGL3 0.67267 signal transduction GO:0007165
5 Q8N9H9 C1orf127 0.64814 anatomical structure development GO:0048856
6 O95361 TRIM16 0.64505 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q86XT2 VPS37D 0.64476 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
8 Q107X0 KLKP1 0.6445
9 Q8TEE9 SAP25 0.64244 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q9Y6X6 MYO16 0.63401 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAA
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             .......................................................DDD.DD......D......................DDDDDDDD..
DO_SPOTD:                DDDDD...............................................DDDDDDDDDDD.....................DDDDDDDDDDDDDDDD
CONSENSUS:               D......................................................DDDDDD.............................DDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                 180              
AA:                      GSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN
STMI:                                                                                                          
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............D
DO_IUPRED2A:             DDDDDDDDD.DDD.............DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDD.DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDD
CONSENSUS_MOBI:          ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PS]:                                                          PeSlPgSSaSvPPPqPaSS                        
RICH_[AL]:                                        ApApAAggprspppLLLL                                           
RICH_[AP]:                           APAlfrPctPAvwAPAPAAggPrsPPPllllP                                          
RICH_[A]:                            ApAlfrpctpAvwApApAA                                                       
RICH_[P]:                                  PctPavwaPaPaaggPrsPPPllllPeslP                                      
RICH_[S]:                                                             SlpgSSaSvpppqpaSS                        
RICH_[LP]:                                         PaPaaggPrsPPPLLLLPesLPgssasvPPPqP                           
RICH_fLPS_[A]:                      eApAlfrpctpAvwApApAA                                                       
RICH_fLPS_[L]:                                                ppLLLLpesL                                       
RICH_MOBI_[PS]:                                                     PeSlPgSSaSvPPPqPaSS                        
RICH_MOBI_[P]:                                       PaaggPrsPPPllllPeslP                                      
RICH_MOBI_[GW]:                                                                              GlGlrvWrpWGspG    
RICH_MOBI_[LP]:                                      PaaggPrsPPPLLLLPesLP                                      
RICH_fLPS_MOBI_[L]:                                      gprspppLLLLpesL