Q5U649 CL060_HUMAN
Gene name: C12orf60
Protein name: Uncharacterized protein C12orf60
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O43301 | HSPA12A | 0.99905 | |
2 | Q96KR6 | FAM210B | 0.9985 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
3 | Q9Y5L2 | HILPDA | 0.9984 |
cell population proliferation
GO:0008283 cell-cell signaling GO:0007267 response to stress GO:0006950 |
4 | Q9UIK5 | TMEFF2 | 0.99571 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
5 | P20138 | CD33 | 0.99464 |
cell adhesion
GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
6 | P25089 | FPR3 | 0.96999 |
homeostatic process
GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
7 | Q8WUJ0 | STYX | 0.96303 |
catabolic process
GO:0009056 cellular protein modification process GO:0006464 nucleocytoplasmic transport GO:0006913 ... |
8 | P48960 | ADGRE5 | 0.95997 |
cell adhesion
GO:0007155 cell-cell signaling GO:0007267 immune system process GO:0002376 ... |
9 | Q9HC84 | MUC5B | 0.91154 |
biosynthetic process
GO:0009058 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
10 | Q8N8R7 | ARL14EP | 0.9001 |
20 40 60 80 100
AA: MSSESEKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVKNNSYIKDFFEQMLKIFKEMQSVVDARHDKIQKESLCSKVAMAMCSVVQK
STMI:
DO_DISOPRED3: DDDDDD..............................................................................................
DO_IUPRED2A: DDDD................................................................................................
DO_SPOTD: DDDDD...............................................................................................
CONSENSUS: DDDDD...............................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200
AA: STNVEELHQSAKEVFKSAHTPVIISVLNSSNILGSLESSLSHLMKFPIMNLQLSDFYTEDTKEQSDVTTSERTRSPPGSSKTTMIDTLKKLQDVLKTEDS
STMI:
DO_DISOPRED3: ................................................................DDDDDDDDDDDDDDDDDD..................
DO_IUPRED2A: .............................................................DDDDDDDDDDDDDDDDDDDDDDD...........DDDDD
DO_SPOTD: .............................................................DDDDDDDDDDDDDDDDDDDD...................
CONSENSUS: .............................................................DDDDDDDDDDDDDDDDDDDDD..................
CONSENSUS_MOBI: .............................................................DDDDDDDDDDDDDDDDDDDDDD.................
RICH_[T]: TTserTrsppgsskT
RICH_MOBI_[T]: TTserTrsppgsskTT
220 240
AA: KNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASDK
STMI:
DO_DISOPRED3: ..........................................DDD
DO_IUPRED2A: .DD..DD......................................
DO_SPOTD: .......................................DDDDDD
CONSENSUS: ..........................................DDD
CONSENSUS_MOBI: .............................................