Q5VTU8 AT5EL_HUMAN
Gene name: ATP5F1EP2
Protein name: ATP synthase subunit epsilon-like protein, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MVAYWRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKIVKVKKE STMI: DO_DISOPRED3: ................................................... DO_IUPRED2A: ................................................... DO_SPOTD: ..................................DDDDDDDD......DDD CONSENSUS: ................................................... CONSENSUS_MOBI: ...................................................