Q69YU5 BWNIN_HUMAN

Gene name: BRAWNIN
Protein name: Protein BRAWNIN

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9ULB4 CDH9 0.74961 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
2 Q96P65 QRFPR 0.71277 signal transduction GO:0007165
3 P08567 PLEK 0.70543 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
4 Q16787 LAMA3 0.69729 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
5 Q06730 ZNF33A 0.68106 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q3SXM0 DCAF4L1 0.67816
7 P57057 SLC37A1 0.67697 transmembrane transport GO:0055085
transport GO:0006810
8 Q9GZV3 SLC5A7 0.67479 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell-cell signaling GO:0007267
...
9 Q92670 ZNF75CP 0.67218
10 Q4J6C6 PREPL 0.6676 cell-cell signaling GO:0007267
protein transport GO:0015031
transport GO:0006810
...

                                           20                  40                  60         
AA:                      MPAGVPMSTYLKMFAASLLAMCAGAEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEELK
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSS                                              
DO_DISOPRED3:            D...........................................................DDDDDDDDDDD
DO_IUPRED2A:             ..........................................DD....DDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                        .................DD....DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                   ..............................................
RICH_[K]:                                                                KtellglKerKhK          
RICH_[EL]:                                                                 ELLgLkErkhkpqvsqqEEL 
RICH_[KL]:                                                                  LLgLKerKhKpqvsqqeeLK