Q6IAA8 LTOR1_HUMAN

Gene name: LAMTOR1
Protein name: Ragulator complex protein LAMTOR1

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell cycle GO:0007049
- cellular protein modification process GO:0006464
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NCS7 SLC44A5 0.68601 biosynthetic process GO:0009058
transmembrane transport GO:0055085
transport GO:0006810
2 Q9BWW8 APOL6 0.65431 transport GO:0006810
3 P61266 STX1B 0.64462 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 Q12846 STX4 0.62082 cell adhesion GO:0007155
cell death GO:0008219
cell population proliferation GO:0008283
...
5 Q9H6Y2 WDR55 0.6203 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
6 Q8IVU9 CABCOCO1 0.61834
7 O14939 PLD2 0.60619 biosynthetic process GO:0009058
catabolic process GO:0009056
cytoskeleton organization GO:0007010
...
8 Q9BS91 SLC35A5 0.59428 transport GO:0006810
9 P47712 PLA2G4A 0.5926 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
10 O00478 BTN3A3 0.57695 immune system process GO:0002376
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLT
STMI:                                                                                                                        
DO_DISOPRED3:            ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................
DO_IUPRED2A:             ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......D..............DDD.DD.DDDDDDDDD................
DO_SPOTD:                .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................
CONSENSUS:               ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................
RICH_[D]:                          DsDqDreerklllD                                                                            
RICH_[DE]:                      EnEDsDqDrEErklllD                                                                            
RICH_[LP]:                                   LLLdPssPPtkaLngaeP                                                              
RICH_MOBI_[D]:                     DsDqDreerklllD                                                                            
RICH_MOBI_[L]:                               LLLdpsspptkaL                                                                   
RICH_MOBI_[CD]:            CCysseneDsDqD                                                                                     
RICH_MOBI_[CE]:            CCyssEnEdsdqdrEE                                                                                  
RICH_MOBI_[DE]:                 EnEDsDqDrEErklllD                                                                            
RICH_MOBI_[DL]:                    DsDqDreerkLLLD                                                                            

                                          120                 140                 160                   
AA:                      HWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP
STMI:                                                                                 
DO_DISOPRED3:            .............................................................
DO_IUPRED2A:             .....DD.....DDDD.............................................
DO_SPOTD:                .............................................................
CONSENSUS:               .............................................................
CONSENSUS_MOBI:          .............................................................