Q6P161 RM54_HUMAN
Gene name: MRPL54
Protein name: 39S ribosomal protein L54, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H2X3 | CLEC4M | 0.62094 | biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 immune system process GO:0002376 ... |
| 2 | Q9UBR1 | UPB1 | 0.59106 | |
| 3 | Q8IUQ0 | CLVS1 | 0.54598 | |
| 4 | Q03405 | PLAUR | 0.5331 | |
| 5 | P12883 | MYH7 | 0.53305 | anatomical structure development GO:0048856 circulatory system process GO:0003013 response to stress GO:0006950 |
| 6 | A2A2Y4 | FRMD3 | 0.51423 | cytoskeleton organization GO:0007010 |
| 7 | Q12988 | HSPB3 | 0.51414 | response to stress GO:0006950 |
| 8 | Q96FZ2 | HMCES | 0.49053 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 9 | Q8IYE1 | CCDC13 | 0.48941 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 response to stress GO:0006950 |
| 10 | Q7RTR2 | NLRC3 | 0.48617 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMN STMI: TTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDD..............................DDDDDDDDDDDDDDD.............................................. DO_IUPRED2A: ..........................................DD.DDDDDDDDDDDD........................................... DO_SPOTD: DDD....................................DDDDDDDDDDDDDDDDDDD.......................................... CONSENSUS: .........................DDDDDDDDDDDDDDDDDD........................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[AK]: ArdyAKKpvmKgAKsgKgA RICH_MOBI_[AL]: AweLLnpAtsgrLLArdyA RICH_MOBI_[K]: KKpvmKgaKsgKgavtsealK RICH_MOBI_[L]: LLnpatsgrLL Lfemn RICH_MOBI_[T]: TsealkdpdvcTdpvqlTT RICH_MOBI_[TV]: VcTdpVqlTT RICH_MOBI_[EL]: EypEwLfEmn RICH_MOBI_[LW]: WgaWeLLnpatsgrLL
120 AA: LGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL STMI: DO_DISOPRED3: ..................................DDDD DO_IUPRED2A: .....D...D.DD........................D DO_SPOTD: .............................DDDDDDDDD CONSENSUS: ..................................DDDD CONSENSUS_MOBI: DDDDDDDDDDDDD.......................DD RICH_MOBI_[L]: LgppktLeeL RICH_MOBI_[EL]: LgppktLEELdpE