Q6P1X6 CH082_HUMAN
Gene name: C8orf82
Protein name: UPF0598 protein C8orf82
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NCQ5 | FBXO15 | 0.78948 | cellular protein modification process GO:0006464 |
| 2 | Q86UY8 | NT5DC3 | 0.78093 | |
| 3 | Q8WY22 | BRI3BP | 0.72432 | |
| 4 | Q8NEG7 | DENND6B | 0.69939 | |
| 5 | Q96T55 | KCNK16 | 0.6982 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | O43603 | GALR2 | 0.683 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q8N465 | D2HGDH | 0.66858 | small molecule metabolic process GO:0044281 |
| 8 | Q6ZMZ3 | SYNE3 | 0.66071 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cytoskeleton organization GO:0007010 ... |
| 9 | P62917 | RPL8 | 0.63883 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P35030 | PRSS3 | 0.63735 | immune system process GO:0002376 protein maturation GO:0051604 small molecule metabolic process GO:0044281 ... |
20 40 60 80 100 AA: MWPPCGTLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: ..........................DDDDDDDD.................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDD..D.DD........D................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AC]: CgtlrtlAlArsrgArAC RICH_[AG]: AlArsrGArAcsGdGG RICH_[AR]: RtlAlARsRgARA RICH_[A]: AlArsrgArA RICH_[G]: GaracsGdGG RICH_[R]: RtlalaRsRgaR RICH_[CR]: CgtlRtlalaRsRgaRaC RICH_[GR]: RtlalaRsRGaRacsGdGG RICH_[LR]: LRtLaLaRsR
120 140 160 180 200 AA: ERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPALPSHVRWQGRRL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: ALTMDLAPLLLAARSP STMI: DO_DISOPRED3: .............DDD DO_IUPRED2A: ................ DO_SPOTD: .............DDD CONSENSUS: .............DDD CONSENSUS_MOBI: ................