Q6UWT4 CE046_HUMAN
Gene name: C5orf46
Protein name: Uncharacterized protein C5orf46
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9BXN1 | ASPN | 0.83074 |
anatomical structure development
GO:0048856 signal transduction GO:0007165 |
2 | E9PB15 | PTGES3L | 0.80194 |
cellular component assembly
GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
3 | Q86SE9 | PCGF5 | 0.7413 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
4 | O14730 | RIOK3 | 0.73876 |
cellular component assembly
GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome segregation GO:0007059 ... |
5 | Q6ZNG9 | KRBA2 | 0.71638 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 |
6 | Q86VP6 | CAND1 | 0.71518 |
biosynthetic process
GO:0009058 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
7 | Q92882 | OSTF1 | 0.70726 |
immune system process
GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
8 | Q16623 | STX1A | 0.70622 |
cell-cell signaling
GO:0007267 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
9 | Q8TE02 | ELP5 | 0.70356 |
cellular nitrogen compound metabolic process
GO:0034641 |
10 | Q96QF7 | GCNA | 0.69953 |
20 40 60 80
AA: MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRSTGFMEFDDNEGKHSSK
STMI: SSSSSSSSSSSSSSSSSSSSSSS
DO_DISOPRED3: DDDDDDDD.........................................................................DDDDDD
DO_IUPRED2A: ...........................DDDDDDDDDDDDDD..................................D..DD....DDD
DO_SPOTD: DDD....................DDDDDDDDDDDDDDDDDD...............................D.DDDDDDDDDDDDD
CONSENSUS: ....DDDDDDDDDDDDDD..................................D..DDDDDDDDD
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD...........................................
RICH_[D]: DkpDDkpDDsgkD
RICH_fLPS_[D]: DkpDDkpDDsgkD
RICH_MOBI_[D]: DDkpDkpDDkpDDsgkDpkpD
RICH_MOBI_[K]: KpdKpddKpddsgKdpK
RICH_MOBI_[DK]: DDKpDKpDDKpDDsgKDpKpD
RICH_fLPS_MOBI_[D]: DDkpDkpDDkpDDsgkDpkpD