Q6UWT4 CE046_HUMAN
Gene name: C5orf46
Protein name: Uncharacterized protein C5orf46
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BXN1 | ASPN | 0.83074 | anatomical structure development GO:0048856 signal transduction GO:0007165 |
| 2 | E9PB15 | PTGES3L | 0.80194 | cellular component assembly GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
| 3 | Q86SE9 | PCGF5 | 0.7413 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | O14730 | RIOK3 | 0.73876 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome segregation GO:0007059 ... |
| 5 | Q6ZNG9 | KRBA2 | 0.71638 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 |
| 6 | Q86VP6 | CAND1 | 0.71518 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 7 | Q92882 | OSTF1 | 0.70726 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 8 | Q16623 | STX1A | 0.70622 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 9 | Q8TE02 | ELP5 | 0.70356 | cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q96QF7 | GCNA | 0.69953 |
20 40 60 80 AA: MAVSVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRSTGFMEFDDNEGKHSSK STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDD.........................................................................DDDDDD DO_IUPRED2A: ...........................DDDDDDDDDDDDDD..................................D..DD....DDD DO_SPOTD: DDD....................DDDDDDDDDDDDDDDDDD...............................D.DDDDDDDDDDDDD CONSENSUS: ....DDDDDDDDDDDDDD..................................D..DDDDDDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD........................................... RICH_[D]: DkpDDkpDDsgkD RICH_fLPS_[D]: DkpDDkpDDsgkD RICH_MOBI_[D]: DDkpDkpDDkpDDsgkDpkpD RICH_MOBI_[K]: KpdKpddKpddsgKdpK RICH_MOBI_[DK]: DDKpDKpDDKpDDsgKDpKpD RICH_fLPS_MOBI_[D]: DDkpDkpDDkpDDsgkDpkpD