Q6UWV7 SHL2A_HUMAN

Gene name: SHISAL2A
Protein name: Protein shisa-like-2A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P52740 ZNF132 0.88492 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 P04201 MAS1 0.87622 signal transduction GO:0007165
3 O95156 NXPH2 0.86193 signal transduction GO:0007165
4 Q6P9A2 GALNT18 0.83588 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
5 Q9UPY5 SLC7A11 0.80218 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
6 Q86UD3 MARCHF3 0.78673 cellular protein modification process GO:0006464
transport GO:0006810
vesicle-mediated transport GO:0016192
7 O14628 ZNF195 0.76822 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 P47898 HTR5A 0.74484 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
9 Q96GD4 AURKB 0.74329 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q8NEG0 FAM71C 0.70711

                                           20                  40                  60                  80                 100
AA:                      MSGACTSYVSAEQEVVRGFSCPRPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHSYMWWLSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDL
STMI:                                                                   MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM          
DO_DISOPRED3:            DDD.................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DD.............................................................................................DDDDD
CONSENSUS:               DD.............................................                     .                     ..........
CONSENSUS_MOBI:          ...............................................                     .                     ..........

                                          120                 140                 160                 180          
AA:                      GLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSDIPGSPEEASVPNPDLCGPVP
STMI:                                                                                                              
DO_DISOPRED3:            ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................DDDDDDDDDDDDDD
DO_IUPRED2A:             .......................................................................DDDDDDDDDDDDDDDD.D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........................................................................................
RICH_[V]:                           VspdcqgVntgmaaeVpkV