Q6XD76 ASCL4_HUMAN

Gene name: ASCL4
Protein name: Achaete-scute homolog 4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8TDW4 ST7L 0.8911 growth GO:0040007
2 Q7Z2X4 PID1 0.82504 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
3 Q14201 BTG3 0.81178 cell cycle GO:0007049
cell population proliferation GO:0008283
mitotic cell cycle GO:0000278
4 Q9H825 METTL8 0.76329
5 P17936 IGFBP3 0.74296 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
6 Q9BTX7 TTPAL 0.73966
7 Q8TCN5 ZNF507 0.72745
8 O43623 SNAI2 0.71217 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 O43353 RIPK2 0.70129 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q96RU2 USP28 0.67426 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
DO_IUPRED2A:             D.D.....................D.D.........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDD...........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDD...........................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[GL]:                                   LGvpGtLpGL                                                                      
RICH_[LP]:                    PaerLaLPysLrtaPLgvP                                                                            

                                          120                 140                 160        
AA:                      RELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
STMI:                                                                                            
DO_DISOPRED3:            ................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                                                GleGAAGAvpqrrAecnsdG                   
RICH_[A]:                                                     AAgAvpqrrA                         
RICH_[S]:                                                                  SdgeSkaSSapSpSSepeeggS
RICH_[ES]:                                                                 SdgESkaSSapSpSSEpEEggS
RICH_fLPS_[S]:                                                             SdgeSkaSSapSpSS       
RICH_MOBI_[S]:                                                             SdgeSkaSSapSpSS       
RICH_MOBI_[ES]:                                                            SdgESkaSSapSpSSEpEEggS