Q6ZNR0 TMM91_HUMAN

Gene name: TMEM91
Protein name: Transmembrane protein 91

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H8W4 PLEKHF2 0.78494 protein transport GO:0015031
transport GO:0006810
2 Q16828 DUSP6 0.70393 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 Q96QF7 GCNA 0.70072
4 Q9UJZ1 STOML2 0.6459 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9BXN1 ASPN 0.63247 anatomical structure development GO:0048856
signal transduction GO:0007165
6 Q92805 GOLGA1 0.62947
7 Q15653 NFKBIB 0.62648 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
signal transduction GO:0007165
8 E9PB15 PTGES3L 0.62058 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
9 Q8NC42 RNF149 0.61542 catabolic process GO:0009056
cellular protein modification process GO:0006464
signal transduction GO:0007165
10 Q8NDX6 ZNF740 0.59957 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV
STMI:                                                                                                                     MMM
DO_DISOPRED3:            DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................D.DDDDDDDDDDDDDDDDDDDDD..DDD...............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........   
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............   
RICH_[D]:                                                                                   DveDmsssDsDsDwD                  
RICH_[P]:                                                                   PPlPsvsaglgePrPP                                 
RICH_[S]:                                                                                        SSSdSdSdwdggS               
RICH_[DS]:                                                                                  DveDmSSSDSDSDwDggS               
RICH_[EL]:                    LrELqqpLLEgtEcE                                                                                
RICH_[LP]:                                                             LqfLsPPLPsvsagLgePrP                                  
RICH_fLPS_[D]:                                                                         eprppDveDmsssDsDsDwD                  
RICH_MOBI_[D]:                                                                              DveDmsssDsDsDwD                  
RICH_MOBI_[DS]:                                                                             DveDmSSSDSDSDwD                  
RICH_MOBI_[EL]:               LrELqqpLLEgtEcE                                                                                
RICH_fLPS_MOBI_[D]:                                                                         DveDmsssDsDsDwD                  

                                          120                 140                 160        
AA:                      FSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP
STMI:                    MMMMMMMMMMMMMMMMMM                     MMMMMMMMMMMMMMMMMMMMM            
DO_DISOPRED3:            .....................................................................DDD
DO_IUPRED2A:             ........................................................................
DO_SPOTD:                .............................DDDDDDDDDDDDDDDDDDDDDDDDD...D........DDDDDD
CONSENSUS:                                 .....................                     .........DDD
CONSENSUS_MOBI:                            .....................                     ............