Q6ZP98 CP047_HUMAN

Gene name: C16orf47
Protein name: Putative uncharacterized protein C16orf47

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P02538 KRT6A 0.74943 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
...
2 Q9BZD2 SLC29A3 0.74412
3 P48668 KRT6C 0.73488 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
4 Q7RTX7 CATSPER4 0.73184 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
5 Q9H1K4 SLC25A18 0.7209 generation of precursor metabolites and energy GO:0006091
transmembrane transport GO:0055085
transport GO:0006810
6 Q7Z460 CLASP1 0.69982 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
7 O75143 ATG13 0.69032 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
8 O60333 KIF1B 0.69032 cell death GO:0008219
cell-cell signaling GO:0007267
cytoskeleton-dependent intracellular transport GO:0030705
...
9 P04259 KRT6B 0.67876 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
10 Q9UPU5 USP24 0.66236 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MVSSFAGIREIEKLRHKEVNKSQQGTGPGLEPRGSNSRTSATSSGTKRQLHRVLRGQWLSSSAPVSSAEPKASHLCIQGLSSSPIHHQGPVILPVDARLS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD...............DDD.DDDDDDDDDDDD...DD........................DDDDDDDDDDD........................
DO_IUPRED2A:             ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................D....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
CONSENSUS:               DDDDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDD....................
CONSENSUS_MOBI:          ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
RICH_[G]:                                        GtGpGleprG                                                                  
RICH_[S]:                                                  SnSrtSatSS                                                        
RICH_[ST]:                                                   SrTSaTSSgT                                                      
RICH_MOBI_[G]:                                   GtGpGleprG                                                                  
RICH_MOBI_[S]:                                             SnSrtSatSS                                                        
RICH_MOBI_[ST]:                                              SrTSaTSSgT                                                      

                                          120       
AA:                      LDVSVPEQRCSSYYLGRLWPQKYLVSSHSVKWN
STMI:                                                     
DO_DISOPRED3:            .................................
DO_IUPRED2A:             .................................
DO_SPOTD:                .................................
CONSENSUS:               .................................
CONSENSUS_MOBI:          .................................