Q6ZWK4 RHEX_HUMAN

Gene name: RHEX
Protein name: Regulator of hemoglobinization and erythroid cell expansion protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- developmental maturation GO:0021700
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96CJ1 EAF2 0.72985 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
2 Q9H8W4 PLEKHF2 0.71912 protein transport GO:0015031
transport GO:0006810
3 Q92805 GOLGA1 0.71594
4 Q9H8M9 EVA1A 0.70617 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
5 Q9UJZ1 STOML2 0.68151 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
6 Q6ZTR5 CFAP47 0.67499
7 Q68D20 PMS2CL 0.66742
8 Q96QF7 GCNA 0.66153
9 Q96S38 RPS6KC1 0.65077 signal transduction GO:0007165
10 Q8N4U5 TCP11L2 0.63892 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MLTEVMEVWHGLVIAVVSLFLQACFLTAINYLLSRHMAHKSEQILKAASLQVPRPSPGHHHPPAVKEMKETQTERDIPMSDSLYRHDSDTPSDSLDSSCS
STMI:                            MMMMMMMMMMMMMMMMMMMMM                                                                       
DO_DISOPRED3:            D.............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ........                     .................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........                     ......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                                                           DipmsDslyrhDsDtpsDslD    
RICH_[S]:                                                                                               SdSlyrhdSdtpSdSldSScS
RICH_[CD]:                                                                                                     DsDtpsDslDssCs
RICH_[CS]:                                                                                                      SdtpSdSldSSCS
RICH_[DS]:                                                                                              SDSlyrhDSDtpSDSlDSScS
RICH_[HP]:                                                                   PrPsPgHHHPP                                     
RICH_fLPS_[S]:                                                                                                      SdSldSScS
RICH_MOBI_[D]:                                                                                      DipmsDslyrhDsDtpsDslD    
RICH_MOBI_[S]:                                                                                            SlyrhdSdtpSdSldSScS
RICH_MOBI_[CD]:                                                                                                DsDtpsDslDssCs
RICH_MOBI_[CS]:                                                                                                 SdtpSdSldSSCS
RICH_MOBI_[DS]:                                                                                         SDSlyrhDSDtpSDSlDSScS
RICH_MOBI_[HP]:                                                              PrPsPgHHHPP                                     
RICH_fLPS_MOBI_[D]:                                                                                 DipmsDslyrhDsDtpsDslD    

                                          120                 140                 160        
AA:                      SPPACQATEDVDYTQVVFSDPGELKNDSPLDYENIKEITDYVNVNPERHKPSFWYFVNPALSEPAEYDQVAM
STMI:                                                                                            
DO_DISOPRED3:            DDDDDD..................................................................
DO_IUPRED2A:             DDD.DD.........DDDD....DD.DDDDDDD.DDDDDDDDD.......................DDDDDD
DO_SPOTD:                DDDDDDDD..............................................................DD
CONSENSUS:               DDDDDD................................................................DD
CONSENSUS_MOBI:          DDDDDD..................................................................
RICH_[S]:                S                                                                       
RICH_[CD]:               sppaC                                                                   
RICH_[CS]:               SppaC                                                                   
RICH_[DS]:               S                                                                       
RICH_fLPS_[S]:           S                                                                       
RICH_MOBI_[S]:           S                                                                       
RICH_MOBI_[CD]:          sppaC                                                                   
RICH_MOBI_[CS]:          SppaC                                                                   
RICH_MOBI_[DS]:          S