Q75L30 YG027_HUMAN

Protein name: Putative uncharacterized protein FLJ92257

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H0V9 LMAN2L 0.58469 protein folding GO:0006457
protein transport GO:0015031
transport GO:0006810
...
2 Q6ZVW7 IL17REL 0.58469
3 Q6ZWC4 n/a 0.5174
4 Q96LA6 FCRL1 0.44723 immune system process GO:0002376
signal transduction GO:0007165
5 Q99572 P2RX7 0.44325 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
6 Q9NSD5 SLC6A13 0.44198 circulatory system process GO:0003013
transport GO:0006810
7 Q9UPG8 PLAGL2 0.43883 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
8 Q9UBB6 NCDN 0.43399 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
9 Q9H0T7 RAB17 0.43182 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
10 Q86TJ5 ZNF554 0.42728

                                           20                  40                  60                  80                 100
AA:                      MATFPGQVSTYFLAAWTGPGPATHWPLYAQLMPHSGLSRPSSCPGTSSPGPKLPQVGLSRPSCCLPAFSPGLALPPGCIYKTNSCLTTTFYGSAPAQLLP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD.D..D...........................DDD.........................DD.DDDDDD.DDD..DDDDDD.D.D
DO_IUPRED2A:             .........................................DDDDDDDDDDD................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[CT]:                                                                                            CiykTnsClTTT           
RICH_[CY]:                                                                                            CiYktnsCltttfY         
RICH_[TY]:                                                                                              YkTnsclTTTfY         
RICH_[LP]:                                                                                                             PaqLLP

                                          120           
AA:                      AFVGPKLPQVKLFRPTFCLAVACTDPALA
STMI:                                                 
DO_DISOPRED3:            D...DDD.DDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................
RICH_[AC]:                                ClAvACtdpAlA
RICH_[A]:                                   AvActdpAlA
RICH_[CF]:                           FrptFClavaC      
RICH_[LP]:               afvgPkLPqvkLfrP