Q7Z2W9 RM21_HUMAN

Gene name: MRPL21
Protein name: 39S ribosomal protein L21, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P49356 FNTB 0.96522 cellular protein modification process GO:0006464
signal transduction GO:0007165
2 Q12918 KLRB1 0.73534 immune system process GO:0002376
signal transduction GO:0007165
3 Q14765 STAT4 0.73486 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...
4 P56749 CLDN12 0.68622 cell adhesion GO:0007155
homeostatic process GO:0042592
5 Q5SZK8 FREM2 0.68115 anatomical structure development GO:0048856
cell adhesion GO:0007155
embryo development GO:0009790
6 Q8NFY9 KBTBD8 0.66589 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 P30281 CCND3 0.65226 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
8 P53355 DAPK1 0.65119 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
9 P62955 CACNG7 0.65033 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
10 P14921 ETS1 0.63464 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MAASSLTVTLGRLASACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVH
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D...............................
DO_IUPRED2A:             .............................................................D....DDD...............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
CONSENSUS:                                                      DDDDDDDDDDDDDDDDDDDDDDD......D...............................
CONSENSUS_MOBI:                                                 DDDDDDDDD....................................................
RICH_[PS]:                                                       SqStSylPgyvPktSlSSPP                                        
RICH_[PY]:                                                            YlPgYvPktslssPPwP                                      
RICH_[S]:                                                        SqStSylpgyvpktSlSS                                          
RICH_[SY]:                                                       SqStSYlpgYvpktSlSS                                          

                                          120                 140                 160                 180                 200
AA:                      FASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEI
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                        
AA:                      APCLL
STMI:                         
DO_DISOPRED3:            .....
DO_IUPRED2A:             .....
DO_SPOTD:                .....
CONSENSUS:               .....
CONSENSUS_MOBI:          ....D