Q7Z4L0 COX8C_HUMAN
Gene name: COX8C
Protein name: Cytochrome c oxidase subunit 8C, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 60 AA: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTT MMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDD...................................................................D DO_IUPRED2A: ...........................D.DDDDDD..................................... DO_SPOTD: DDDDDDDDDDDD......................................................DDDDDD CONSENSUS: ........... .......D CONSENSUS_MOBI: ........... ........