Q7Z5L4 SPT19_HUMAN
Gene name: SPATA19
Protein name: Spermatogenesis-associated protein 19, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92565 | RAPGEF5 | 0.62984 | anatomical structure development GO:0048856 signal transduction GO:0007165 |
| 2 | Q5SWX8 | ODR4 | 0.60193 | |
| 3 | Q9BQ31 | KCNS3 | 0.56797 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 protein transport GO:0015031 ... |
| 4 | P22223 | CDH3 | 0.54917 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 5 | Q9UJZ1 | STOML2 | 0.46082 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q13634 | CDH18 | 0.45835 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 7 | P51811 | XK | 0.45509 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 8 | Q8N4E4 | PDCL2 | 0.45179 | |
| 9 | P49281 | SLC11A2 | 0.44316 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 10 | Q9NRF8 | CTPS2 | 0.4377 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLL STMI: TTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............. DO_SPOTD: ....................................................D..DDDDDDDDDDDDDDDDDDDDDDDDDDDD................. CONSENSUS: ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................. CONSENSUS_MOBI: ............................................................................
120 140 160 AA: ANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC STMI: DO_DISOPRED3: .................................................................DD DO_IUPRED2A: .............................DDD..DDDDDD.D...DD....DDDDDDDDDDDDDDDD DO_SPOTD: ...................................................DDDDDDDDDDDDDDDD CONSENSUS: ...................................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................... RICH_[DS]: DvSaqDfSmrpSSSD