Q7Z6I8 CE024_HUMAN

Gene name: C5orf24
Protein name: UPF0461 protein C5orf24

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WWV6 FCAMR 0.59269 immune system process GO:0002376
2 Q14203 DCTN1 0.52801 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
3 Q68BL7 OLFML2A 0.52279 extracellular matrix organization GO:0030198
4 Q4KWH8 PLCH1 0.48594 biosynthetic process GO:0009058
catabolic process GO:0009056
homeostatic process GO:0042592
...
5 O15440 ABCC5 0.48044 biosynthetic process GO:0009058
circulatory system process GO:0003013
small molecule metabolic process GO:0044281
...
6 Q9UBU8 MORF4L1 0.4789 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
...
7 Q76M96 CCDC80 0.47846 cell adhesion GO:0007155
extracellular matrix organization GO:0030198
8 Q6UXF1 TMEM108 0.47768 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
9 P56975 NRG3 0.47623 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 Q96RR1 TWNK 0.4698 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD........................................................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDD.DDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD..........................................................DDDDDDDDDDDDDDDDDDDDDD
RICH_[QY]:                                             QfdiYssQQskY                                                          
RICH_[RT]:                                                                                                        RgRpsgTTksa
RICH_[K]:                                                                                          KdelKKKKnlnrsgKrgrpsgttK  
RICH_[Q]:                                                     QQskyshtvnhkpmvcQrQ                                            
RICH_[R]:                                                                                                     RsgkRgRpsgttksa
RICH_[T]:                                                                                                               TTksa
RICH_[CP]:                  PvassnPafCgPgkPsC                                                                                
RICH_[GR]:                                                                                                    RsGkRGRpsGttksa
RICH_[GT]:                                                                                                      GkrGrpsGTTksa
RICH_[IK]:                                                                                      IeIKdelKKKK                  
RICH_[KN]:                                                                                             KKKKNlNrsgK           
RICH_[NR]:                                                                                                 NlNRsgkRgR        
RICH_fLPS_[T]:                                                                                                        sgTTksa
RICH_fLPS_[KT]:                                                                                    KdelKKKKnlnrsgKrgrpsgTTKsa
RICH_fLPS_[K]:                                                                                     KdelKKKKnlnrsgKrgrpsgttK  
RICH_MOBI_[RT]:                                                                                                   RgRpsgTTksa
RICH_MOBI_[K]:                                                                                         KKKKnlnrsgKrgrpsgttK  
RICH_MOBI_[R]:                                                                                                RsgkRgRpsgttksa
RICH_MOBI_[T]:                                                                                                          TTksa
RICH_MOBI_[CM]:          MMhpvassnpafCgpgkpsC                                                                                
RICH_MOBI_[GR]:                                                                                               RsGkRGRpsGttksa
RICH_MOBI_[GT]:                                                                                                 GkrGrpsGTTksa
RICH_MOBI_[KN]:                                                                                        KKKKNlNrsgK           
RICH_MOBI_[NR]:                                                                                            NlNRsgkRgR        
RICH_fLPS_MOBI_[T]:                                                                                                   sgTTksa
RICH_fLPS_MOBI_[TK]:                                                                                   KKKKnlnrsgKrgrpsgTTKsa
RICH_fLPS_MOBI_[K]:                                                                                    KKKKnlnrsgKrgrpsgttK  

                                          120                 140                 160                 180            
AA:                      GYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE
STMI:                                                                                                            
DO_DISOPRED3:            DDDDDDDDDD.................................................................DDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................
RICH_[AG]:                             AAGfktspGrplGttkAAG                                                       
RICH_[AT]:                           TkAAgfkTspgrplgTTkAA                                                        
RICH_[RT]:               gyRTsTgR                                                                                
RICH_[R]:                gyR                                                                                     
RICH_[T]:                gyrTsTgrplgTTkaagfkT                                                                    
RICH_[GP]:                                    PGrPlGttkaaGykvsPGrPPG                                             
RICH_[GR]:               GyR                                                                                     
RICH_[GT]:               GyrTsTGrplGTT                                                                           
RICH_[HV]:                                                                                   HgraVHgVeetsseV     
RICH_fLPS_[T]:           gyrTsTgrplgTT                                                                           
RICH_fLPS_[KT]:          gyrTsTgrplgTTK                                                                          
RICH_MOBI_[AG]:                        AAGfktspGrplGttkAAG                                                       
RICH_MOBI_[AT]:                      TkAAgfkTspgrplgTTkAA                                                        
RICH_MOBI_[RT]:          gyRTsTgR                                                                                
RICH_MOBI_[R]:           gyR                                                                                     
RICH_MOBI_[T]:           gyrTsTgrplgTTkaagfkT                                                                    
RICH_MOBI_[GR]:          GyR                                                                                     
RICH_MOBI_[GT]:          GyrTsTGrplGTT                                                                           
RICH_fLPS_MOBI_[T]:      gyrTsTgrplgTT                                                                           
RICH_fLPS_MOBI_[TK]:     gyrTsTgrplgTTK