Q86UQ5 GTSC1_HUMAN

Gene name: GTSCR1
Protein name: Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8TCG1 CIP2A 0.74504 cell population proliferation GO:0008283
reproduction GO:0000003
2 Q32ZL2 PLPPR5 0.69438 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
3 O00180 KCNK1 0.65836 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
4 Q9H2U9 ADAM7 0.59136
5 O14495 PLPP3 0.58435 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell-cell signaling GO:0007267
...
6 P49910 ZNF165 0.56147 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9Y6R6 ZNF780B 0.47309
8 Q8NI22 MCFD2 0.47084 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
9 Q13557 CAMK2D 0.465 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
10 Q9NYT0 PLEK2 0.43986 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MQSDIYHPGHSFPSWVLCWVHSCGHEGHLRETAEIRKTHQNGDLQIRGGRGRRESTEIFQVASVTEGEESPPAICMEVFLFLWFIAPIYACVCRIFKIQV
STMI:                                                                                            MMMMMMMMMMMMMMMMMMMMM       
DO_DISOPRED3:            DDDD................................................................................................
DO_IUPRED2A:             ..............................DDDDD....DDDDDDDDD..........D.DDD.....................................
DO_SPOTD:                DDDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS:               DDDD..........................DDDDD....DDDDDDDDD........................                     .......
CONSENSUS_MOBI:          ........................................................................                     .......

                                          120    
AA:                      RNTVKNSSTASLAPSISTSEERQIRIERHHYHLYGQ
STMI:                                                        
DO_DISOPRED3:            .................DDD..DDDDDDDDDDDDDD
DO_IUPRED2A:             ..........DDD.D.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................
RICH_[I]:                               IstseerqIrI          
RICH_[HI]:                              IstseerqIrIerHH