Q86Y27 BAGE5_HUMAN
Gene name: BAGE5
Protein name: B melanoma antigen 5
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MAAGAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF STMI: SSSSSSSSSSSSSSSSS DO_DISOPRED3: DD......................................... DO_IUPRED2A: ........................................... DO_SPOTD: DDDD....................................... CONSENSUS: .......................... CONSENSUS_MOBI: ..........................