Q8IU54 IFNL1_HUMAN
Gene name: IFNL1
Protein name: Interferon lambda-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q12913 | PTPRJ | 0.80218 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q96FE7 | PIK3IP1 | 0.74329 | signal transduction GO:0007165 |
| 3 | Q8NBV8 | SYT8 | 0.73931 | cell-cell signaling GO:0007267 reproduction GO:0000003 transport GO:0006810 ... |
| 4 | Q13423 | NNT | 0.70711 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 5 | O43316 | PAX4 | 0.70516 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q9ULE6 | PALD1 | 0.68374 | |
| 7 | O95243 | MBD4 | 0.62244 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q5JSL3 | DOCK11 | 0.57336 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | Q96S53 | TESK2 | 0.49545 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 10 | Q8WTR4 | GDPD5 | 0.48748 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLK STMI: SSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: ........................D.DDDDD..................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD..DDDDDDDD...................................................................... CONSENSUS: .....DDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................ RICH_MOBI_[GT]: GpvpTskpTTTGkGchiG
120 140 160 180 AA: VLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST STMI: DO_DISOPRED3: ...................................DDDDDDDDDDDDDDDDDD............................................DDD DO_IUPRED2A: ..................................DDDDD..DDDDDDDDDD...........................................DDD..D DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................DDDD CONSENSUS: ..................................DDDDDDDDDDDDDDDDDDD...........................................DDDD CONSENSUS_MOBI: ..................................DDDDDD.................................................DDDDDDDDDDD