Q8IVK1 GLCM1_HUMAN

Gene name: GLYCAM1
Protein name: Putative glycosylation-dependent cell adhesion molecule 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40             
AA:                      MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP
STMI:                    SSSSSSSSSSSSSSSSSS                             
DO_DISOPRED3:            DDDDDD.D.......................................
DO_IUPRED2A:             ............................................DDD
DO_SPOTD:                DDDD................................DDDDDDDDDDD
CONSENSUS:                                 ..........................DDD
CONSENSUS_MOBI:                            .............................