Q8IVK1 GLCM1_HUMAN
Gene name: GLYCAM1
Protein name: Putative glycosylation-dependent cell adhesion molecule 1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDD.D....................................... DO_IUPRED2A: ............................................DDD DO_SPOTD: DDDD................................DDDDDDDDDDD CONSENSUS: ..........................DDD CONSENSUS_MOBI: .............................