Q8IX95 CTGE3_HUMAN
Gene name: CTAGE3P
Protein name: Putative cTAGE family member 3
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P10523 | SAG | 0.93713 | signal transduction GO:0007165 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | P20645 | M6PR | 0.93606 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 3 | P43632 | KIR2DS4 | 0.8794 | immune system process GO:0002376 response to stress GO:0006950 |
| 4 | Q14954 | KIR2DS1 | 0.8794 | immune system process GO:0002376 response to stress GO:0006950 |
| 5 | Q8N743 | KIR3DL3 | 0.8794 | |
| 6 | P43631 | KIR2DS2 | 0.8794 | immune system process GO:0002376 response to stress GO:0006950 |
| 7 | Q96D46 | NMD3 | 0.84562 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nucleocytoplasmic transport GO:0006913 ... |
| 8 | Q9UBS8 | RNF14 | 0.80087 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q2NL67 | PARP6 | 0.80057 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | Q6ZMW3 | EML6 | 0.77636 |
20 40 60 80 100 AA: MTFKGFQMNEEKLEIGIQDASSENCQLQESQKQLLQEAEVWKEQVSELNKQKITFEDSKVHAEQVLNDKENHIETLTERLLKIKDQAAVLEEDITDDGNL STMI: DO_DISOPRED3: D.........................................................................................DDDDDDDDDD DO_IUPRED2A: .............D..DDDDD.DD.DDDDD.................................DDDDDD..............................D DO_SPOTD: DDDDDDDDDDDDD.DDD..DDD.............................DDDD.DDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDDDDDDD CONSENSUS: D...............DDDDD..........................................DDDDDD.....................DDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[D]: DitDDgnl RICH_[DE]: EEDitDDgnl RICH_[LN]: NL
120 140 AA: ELEMNSELKDGAYLDNPPKGALKKLIHAAKLNASLTTLEGERNQFIFSYLKLIKPGRA STMI: DO_DISOPRED3: DDDDDDDDDDDD..........................................DDDD DO_IUPRED2A: DD...DDDDDDDDD............................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDD........................................DDDD CONSENSUS_MOBI: .......................................................... RICH_[D]: elemnselkD RICH_[DE]: ElEmnsElkD RICH_[LN]: eLemNseL