Q8IY95 TM192_HUMAN
Gene name: TMEM192
Protein name: Transmembrane protein 192
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UMZ3 | PTPRQ | 0.81801 | cell differentiation GO:0030154 cellular protein modification process GO:0006464 |
| 2 | P42892 | ECE1 | 0.79291 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | O00292 | LEFTY2 | 0.68061 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 signal transduction GO:0007165 ... |
| 4 | P35606 | COPB2 | 0.65442 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 5 | O75448 | MED24 | 0.63612 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q8N140 | EID3 | 0.62258 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 7 | Q7Z5Y7 | KCTD20 | 0.62109 | |
| 8 | P37023 | ACVRL1 | 0.61504 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q8WVF1 | OSCP1 | 0.60914 | transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q8WWB3 | DYDC1 | 0.59965 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
20 40 60 80 100 AA: MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLVFVVLAFLTGVLCSYPNPNEDKCPGNYTNPLKVQTVIILGK STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................. .......................... CONSENSUS_MOBI: .............................................. .......................... RICH_[D]: DgslDitqsieDDpllD RICH_[DI]: DgslDItqsIeDDpllD RICH_[DL]: DgsLDitqsieDDpLLDaqL RICH_[GM]: MaaGGrMedG
120 140 160 180 200 AA: VILWILHLLLECYIQYHHSKIRNRGYNLIYRSTRHLKRLALMIQSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALELICSLICLLIYTVKIRRFNKA STMI: MMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........................ ............ ........ CONSENSUS_MOBI: ........................ ............ ........
220 240 260 AA: KPEPDILEEEKIYAYPSNITSETGFRTISSLEEIVEKQGDTIEYLKRHNALLSKRLLALTSSDLGCQPSRT STMI: DO_DISOPRED3: ...............DDDD..DDD......................................DDDDDDDDD DO_IUPRED2A: ....................................................................... DO_SPOTD: .............................................................DDDDDDDDDD CONSENSUS: ..............................................................DDDDDDDDD CONSENSUS_MOBI: .......................................................................