Q8N2X6 EXAS1_HUMAN

Gene name: EXOC3-AS1
Protein name: Uncharacterized protein EXOC3-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N8Z3 DIP2C-AS1 0.65287
2 Q9UBG3 CRNN 0.52802 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
3 O15480 MAGEB3 0.52523
4 Q9HCE7 SMURF1 0.52279 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
5 Q15572 TAF1C 0.51597 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q96L96 ALPK3 0.51475 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 P25021 HRH2 0.51466 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
8 P11487 FGF3 0.51118 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell division GO:0051301
...
9 P24592 IGFBP6 0.49825 cell population proliferation GO:0008283
cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
...
10 P43351 RAD52 0.49725 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...

                                           20                  40                  60                  80                 100
AA:                      MPAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPATSRQAALGTSWTQRRTQPLQERSHWHPRGNNASGMGGHRMFPGPLRGPA
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD..D.
CONSENSUS:                                 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                            ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[QR]:                                                                    RQaalgtswtQRRtQplQeR                           
RICH_[QT]:                                                                  TsrQaalgTswTQrrTQplQ                             
RICH_[AG]:                                                                                                                GpA
RICH_[QW]:                                                                            WtQrrtQplQershW                        
RICH_[RW]:                                                                            WtqRRtqplqeRshWhpR                     
RICH_[G]:                                                                                               GnnasGmGGhrmfpGplrG  
RICH_[H]:                                                                                          HwHprgnnasgmggH           
RICH_[Q]:                                                                      QaalgtswtQrrtQplQ                             
RICH_[R]:                                                                     RqaalgtswtqRRtqplqeR                           
RICH_[T]:                                                             TsvipaTsrqaalgTswT                                     
RICH_[W]:                                                                             WtqrrtqplqershW                        
RICH_[GM]:                                                                                              GnnasGMGGhrMfpG      
RICH_[HQ]:                                                                              QrrtQplQersHwH                       
RICH_MOBI_[QR]:                                                               RQaalgtswtQRRtQplQeR                           
RICH_MOBI_[QT]:                                                             TsrQaalgTswTQrrTQplQ                             
RICH_MOBI_[QW]:                                                                       WtQrrtQplQershW                        
RICH_MOBI_[RW]:                                                                       WtqRRtqplqeRshWhpR                     
RICH_MOBI_[G]:                                                                                          GnnasGmGGhrmfpGplrG  
RICH_MOBI_[H]:                                                                                     HwHprgnnasgmggH           
RICH_MOBI_[Q]:                                                                 QaalgtswtQrrtQplQ                             
RICH_MOBI_[R]:                                                                RqaalgtswtqRRtqplqeR                           
RICH_MOBI_[T]:                                                        TsvipaTsrqaalgTswT                                     
RICH_MOBI_[W]:                                                                        WtqrrtqplqershW                        
RICH_MOBI_[GM]:                                                                                         GnnasGMGGhrMfpGplrG  
RICH_MOBI_[HQ]:                                                                         QrrtQplQersHwH                       

                          
AA:                      AQVLENECGSLGRAAEGRS
STMI:                                       
DO_DISOPRED3:            ................DDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD..DDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................
RICH_[AG]:               AqvlenecGslGrAAeG