Q8N3U1 YS014_HUMAN

Protein name: Putative uncharacterized protein LOC400692

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q66K80 RUSC1-AS1 0.69441
2 Q9HBE5 IL21R 0.63046 immune system process GO:0002376
signal transduction GO:0007165
3 P78358 CTAG1A 0.61842 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q6SZW1 SARM1 0.61315 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q9UKU6 TRHDE 0.60292 catabolic process GO:0009056
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
6 Q6ZSJ8 C1orf122 0.60046
7 P50895 BCAM 0.5958 cell adhesion GO:0007155
signal transduction GO:0007165
8 P0DMV9 HSPA1B 0.59492 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 P11142 HSPA8 0.59257 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 A6NJ46 NKX6-3 0.58616 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MPDASLGSLGITWCFLESPLEVSSGRFGLARLLGSQDHGDDPAERGRTATDAWGPSRWGQSPGNGGGYCDASPPSALAPGDRAWALPASPSSGAPASQHC
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD................................................................................................
DO_IUPRED2A:             ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDD....DDDDDD
DO_SPOTD:                DDDDD.............................DDDDDDDDDDDDDDDDDD.D.DD.DDDDDDDDD...DDD.DD............DDDDDD......
CONSENSUS:               DDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DD..........
CONSENSUS_MOBI:          ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                    DhgDDpaergrtatD                                                 
RICH_[G]:                                                                     GpsrwGqspGnGGG                                 
RICH_[GP]:                                                                     PsrwGqsPGnGGGycdasPP                          
RICH_[GW]:                                                            GrtatdaWGpsrWGqspGnGGG                                 
RICH_fLPS_[G]:                                                               wGpsrwGqspGnGGG                                 
RICH_MOBI_[AG]:                                                                          GGGycdAsppsAlApGdrA                 
RICH_MOBI_[AS]:                                                                                                 ASpSSgApAS   
RICH_MOBI_[A]:                                                                                 AsppsAlApgdrAwAlpA            
RICH_MOBI_[D]:                                               DhgDDpaergrtatD                                                 
RICH_MOBI_[G]:                                                                GpsrwGqspGnGGG                                 
RICH_MOBI_[GW]:                                                       GrtatdaWGpsrWGqspGnGGG                                 
RICH_fLPS_MOBI_[G]:                                                          wGpsrwGqspGnGGG                                 

                                          120                 
AA:                      CLEKAGTRTKASPVWGRDGNTWN
STMI:                                           
DO_DISOPRED3:            ...............D.......
DO_IUPRED2A:             DDDD......DDDDDDDDDDDDD
DO_SPOTD:                .....DDDDDDD.....DDDD.D
CONSENSUS:               ..........DDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................