Q8N4H5 TOM5_HUMAN
Gene name: TOMM5
Protein name: Mitochondrial import receptor subunit TOM5 homolog
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI STMI: MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ................................................... DO_IUPRED2A: ................................................... DO_SPOTD: DDDDDD.D.......................................DDDD CONSENSUS: .......................... ...... CONSENSUS_MOBI: .......................... ......