Q8N535 CB052_HUMAN

Gene name: LINC00471
Protein name: Putative uncharacterized protein encoded by LINC00471

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15910 EZH2 0.80634 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
2 Q5VYS8 TUT7 0.79194 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
3 Q14692 BMS1 0.78808 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 Q9H6Y2 WDR55 0.78043 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
5 Q96A33 CCDC47 0.77701 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
6 P27824 CANX 0.77015 biological process involved in symbiotic interaction GO:0044403
immune system process GO:0002376
protein folding GO:0006457
...
7 Q8IVU9 CABCOCO1 0.76888
8 Q96JM7 L3MBTL3 0.76515 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q9NQZ2 UTP3 0.76423 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
10 Q8IZP2 ST13P4 0.76157 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003

                                           20                  40                  60                  80                 100
AA:                      MSEAKDNGSRDEVLVPHKNCRKNTTVPGKKGEEKSLAPVFAEKLISPSRRGAKLKDRESHQENEDRNSELDQDEEDKESFCRGFPMSGCELETSCCVCHS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDD....DDDDDDDDD.............................DDDDDDDDDDDDDDDD..........................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD......................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................
RICH_[D]:                                                                       DreshqeneDrnselDqDeeD                        
RICH_[E]:                                                                         EshqEnEdrnsEldqdEEdkE                      
RICH_[K]:                                 KncrKnttvpgKKgeeK                                                                  
RICH_[R]:                                                                RRgaklkdReshqenedR                                  
RICH_[DE]:                                                                      DrEshqEnEDrnsElDqDEEDkE                      
RICH_[EN]:                                                                        EshqENEdrN                                 
RICH_MOBI_[D]:                                                                  DreshqeneDrnselDqDeeD                        
RICH_MOBI_[E]:                                                                    EshqEnEdrnsEldqdEE                         
RICH_MOBI_[K]:                            KncrKnttvpgKKgeeK                                                                  
RICH_MOBI_[R]:                                                           RRgaklkdReshqenedR                                  
RICH_MOBI_[DE]:                                                                 DrEshqEnEDrnsElDqDEED                        

                                     
AA:                      TALGERFC
STMI:                            
DO_DISOPRED3:            ........
DO_IUPRED2A:             ........
DO_SPOTD:                DDDDDD..
CONSENSUS:               ........
CONSENSUS_MOBI:          ........