Q8N5G0 SIM20_HUMAN
Gene name: SMIM20
Protein name: Small integral membrane protein 20
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 60 AA: MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDD.................................................... DO_IUPRED2A: ................................................................... DO_SPOTD: DD...........................................................DDDDDD CONSENSUS: DD.... ........................................ CONSENSUS_MOBI: ...... ........................................