Q8N6F1 CLD19_HUMAN

Gene name: CLDN19
Protein name: Claudin-19

List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- nervous system process GO:0050877
- response to stress GO:0006950
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N6K4 n/a 0.88865
2 P09564 CD7 0.88373 immune system process GO:0002376
signal transduction GO:0007165
3 P40197 GP5 0.88267 cell adhesion GO:0007155
response to stress GO:0006950
4 Q8N1D0 SLC22A18AS 0.8614
5 Q9H939 PSTPIP2 0.84282 cytoskeleton organization GO:0007010
6 Q7L513 FCRLA 0.84151 cell differentiation GO:0030154
signal transduction GO:0007165
7 Q96RP3 UCN2 0.79194 signal transduction GO:0007165
8 Q99608 NDN 0.78846 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
9 H3BQW9 FAM229A 0.78567
10 Q9H0W8 SMG9 0.78464 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVV
STMI:                           MMMMMMMMMMMMMMMMMMMMM                                                     MMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDD....DD...........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDD.................................................................................................
CONSENSUS:               DDD....                     .....................................................                   
CONSENSUS_MOBI:          .......                     .....................................................                   

                                          120                 140                 160                 180                 200
AA:                      GMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYR
STMI:                    MM               MMMMMMMMMMMMMMMMMMMMM                      MMMMMMMMMMMMMMMMMMMMM                   
DO_DISOPRED3:            ........................................................................................DDDDDDDDDDDD
DO_IUPRED2A:             ............................................................................................DDDDDDDD
DO_SPOTD:                ........................................................................................DDDDDDDDDDDD
CONSENSUS:                 ...............                     ......................                     .......DDDDDDDDDDDD
CONSENSUS_MOBI:            ...............                     ......................                     .........DDDDDDDDDD
RICH_[AP]:                                                                                                                Pyr
RICH_[P]:                                                                                                        PerPnssPqPyr
RICH_MOBI_[P]:                                                                                                      PnssPqPyr

                                          220                
AA:                      PGPSAAAREPVVKLPASAKGPLGV
STMI:                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDD.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:               PgPsAAArePvvklPAsAkgP   
RICH_[A]:                    AAArepvvklpAsA      
RICH_[P]:                PgP                     
RICH_MOBI_[A]:               AAArepvvklpAsA      
RICH_MOBI_[P]:           PgPsaaareP