List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60               
AA:                      MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM
STMI:                                                         MMMMMMMMMMMMMMMMMMMMM       
DO_DISOPRED3:            D...............................................................D
DO_IUPRED2A:             ............DD.....DDDDD.D..D....................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................DDDDD
CONSENSUS:               D...........DD.....DDDDDDDDDD........                     ......D
CONSENSUS_MOBI:          .....................................                     .......