Q8N7L0 F216B_HUMAN

Gene name: FAM216B
Protein name: Protein FAM216B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HCQ5 GALNT9 0.83781 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
2 Q9Y2T4 PPP2R2C 0.83177 cellular protein modification process GO:0006464
3 P41146 OPRL1 0.79778 circulatory system process GO:0003013
homeostatic process GO:0042592
nervous system process GO:0050877
...
4 O95264 HTR3B 0.78235 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
5 Q9HB14 KCNK13 0.7505 transmembrane transport GO:0055085
transport GO:0006810
6 Q7Z6M3 MILR1 0.66471 immune system process GO:0002376
signal transduction GO:0007165
transport GO:0006810
...
7 Q9BZJ6 GPR63 0.64311 signal transduction GO:0007165
8 Q9H300 PARL 0.63224 catabolic process GO:0009056
cell death GO:0008219
protein targeting GO:0006605
...
9 Q9UBV4 WNT16 0.63224 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
10 Q6ZRI8 ARHGAP36 0.62538 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDD........................................................................................DDD
DO_IUPRED2A:             ................................................................................................DDDD
DO_SPOTD:                DDDDDDDDDD.................................................................................DDDDDDDDD
CONSENSUS:               DDDDDDDDD.......................................................................................DDDD
CONSENSUS_MOBI:          ....................................................................................................

                                          120 
AA:                      PQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN
STMI:                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDD........................DDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................................
RICH_[RV]:                            RRcpsVlpVsVVlpRaqskRR     
RICH_[R]:                  RtipRktsamtRR            RaqskRRqvlR 
RICH_[V]:                                  VlpVsVVlpraqskrrqV   
RICH_fLPS_[V]:                          cpsVlpVsVV