Q8N7S2 DNJ5G_HUMAN
Gene name: DNAJC5G
Protein name: DnaJ homolog subfamily C member 5G
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92753 | RORB | 0.68439 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q9Y385 | UBE2J1 | 0.6524 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | Q15075 | EEA1 | 0.62301 | biological process involved in symbiotic interaction GO:0044403 membrane organization GO:0061024 transport GO:0006810 ... |
| 4 | P48549 | KCNJ3 | 0.61992 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 transmembrane transport GO:0055085 ... |
| 5 | A6NNM8 | TTLL13P | 0.61703 | cellular protein modification process GO:0006464 cytoskeleton organization GO:0007010 |
| 6 | Q8WW24 | TEKT4 | 0.58397 | cellular component assembly GO:0022607 |
| 7 | Q9H853 | TUBA4B | 0.56382 | cell cycle GO:0007049 cytoskeleton organization GO:0007010 mitotic cell cycle GO:0000278 |
| 8 | Q4U2R8 | SLC22A6 | 0.55427 | transport GO:0006810 |
| 9 | Q8WYJ6 | SEPTIN1 | 0.54503 | cell cycle GO:0007049 cell division GO:0051301 transport GO:0006810 ... |
| 10 | Q96IR3 | n/a | 0.54437 |
20 40 60 80 100 AA: MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSL STMI: DO_DISOPRED3: DDDDDDDDDDDD........................................................................................ DO_IUPRED2A: ....D............................................................................................... DO_SPOTD: DDDDDDDDDDDDD....................................................................................... CONSENSUS: DDDDDDDDDDDD........................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: GIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF STMI: DO_DISOPRED3: .........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .........................................................DDDDDDDDD....................... DO_SPOTD: ...............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[DF]: DFrseenseDDF RICH_MOBI_[Q]: QdsgrkyQQnvQsQ RICH_MOBI_[DF]: DFrseenseDDF RICH_fLPS_MOBI_[Q]: eQdsgrkyQQnvQsQ