Q8N8I0 SAM12_HUMAN
Gene name: SAMD12
Protein name: Sterile alpha motif domain-containing protein 12
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P2S7 | TTC41P | 0.91756 | |
| 2 | P46059 | SLC15A1 | 0.89443 | protein transport GO:0015031 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | P78348 | ASIC1 | 0.89443 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 4 | Q86V20 | SHLD2 | 0.88492 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 5 | Q5FWF6 | ZNF789 | 0.87416 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q8TCF1 | ZFAND1 | 0.86193 | protein transport GO:0015031 transport GO:0006810 |
| 7 | Q5JPI3 | C3orf38 | 0.86193 | cell death GO:0008219 |
| 8 | Q9NV72 | ZNF701 | 0.85838 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | O43852 | CALU | 0.85328 | cellular protein modification process GO:0006464 |
| 10 | P21246 | PTN | 0.8403 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MAVEALHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQIYSES STMI: DO_DISOPRED3: DD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................... DO_IUPRED2A: ............D...D.DDDD...DD.........DDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... DO_SPOTD: .................DDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................. CONSENSUS: ..................DDDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KnKnfqKvpdqKgtpK
120 140 160 180 200 AA: FKQHDITGRALLRLTDKKLERMGIAQENLRQHILQQVLQLKVREEVRNLQLLTQGTLLLPDGWMDGEIRRKTTLLLGQTGVRENLLLFLHRISIIENSIQ STMI: DO_DISOPRED3: .................................................................DDDDDDDDDDDDDDDDDDD................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: ............................................................DDDDDDDDDDDDDDDDDDDDDD.................. CONSENSUS: .................................................................DDDDDDDDDDDDDDDDD.................. CONSENSUS_MOBI: ....................................................................................................
AA: I STMI: DO_DISOPRED3: . DO_IUPRED2A: . DO_SPOTD: . CONSENSUS: . CONSENSUS_MOBI: .