Q8N8J7 F241A_HUMAN

Gene name: FAM241A
Protein name: Uncharacterized protein FAM241A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NVC6 MED17 0.73564 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 O43824 GTPBP6 0.72316
3 Q5XUX0 FBXO31 0.72305 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
4 Q07864 POLE 0.70819 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
5 Q96S55 WRNIP1 0.69409 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
6 P20290 BTF3 0.69146 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
7 O95907 SLC16A8 0.67367 immune system process GO:0002376
small molecule metabolic process GO:0044281
transport GO:0006810
8 A6NDA9 LRIT2 0.65402
9 Q9UJK0 TSR3 0.64278 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 Q96EK5 KIFBP 0.63364 anatomical structure development GO:0048856
cell differentiation GO:0030154
embryo development GO:0009790
...

                                           20                  40                  60                  80                 100
AA:                      MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHTGEPVGDDYKKMGTLFGELNKNLINMGFTRMYFGERIVEPV
STMI:                                                                                                                       M
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................
DO_IUPRED2A:             ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... 
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................... 
RICH_[AD]:                          DggerDeDgDAlAereAA                                                                       
RICH_[AE]:                             ErdEdgdAlAErEAA                                                                       
RICH_[AG]:                        GGdGGerdedGdAlAereAAGtGwdpGA                                                               
RICH_[AR]:                                      AeReAAgtgwdpgAspRRR                                                          
RICH_[D]:                           DggerDeDgD                                                                               
RICH_[G]:                    GellrGGdGGerdedG                                                                                
RICH_[R]:                                         ReaagtgwdpgaspRRRgqR                                                       
RICH_[DE]:                    EllrggDggErDEDgDalaE                                                                           
RICH_[DG]:                   GellrGGDGGerDeDGDalaereaaG                                                                      
RICH_[EG]:                    EllrGGdGGErdEdGdalaE                                                                           
RICH_[GR]:                                        ReaaGtGwdpGaspRRRGqR                                                       
RICH_fLPS_[G]:               GellrGGdGG                                                                                      
RICH_MOBI_[AD]:                     DggerDeDgDAlAereAA                                                                       
RICH_MOBI_[AE]:                        ErdEdgdAlAErEAA                                                                       
RICH_MOBI_[AG]:                   GGdGGerdedGdAlAereAAGtGwdpGA                                                               
RICH_MOBI_[AR]:                                 AeReAAgtgwdpgAspRRR                                                          
RICH_MOBI_[D]:                      DggerDeDgD                              DveDsqnhtgepvgDD                                 
RICH_MOBI_[G]:               GellrGGdGGerdedG                                                                                
RICH_MOBI_[R]:                                    ReaagtgwdpgaspRRRgqR                                                       
RICH_MOBI_[DE]:               EllrggDggErDEDgDalaE                      EsEqDvEDsqnhtgEpvgDD                                 
RICH_MOBI_[DG]:              GellrGGDGGerDeDGDalaereaaG                                                                      
RICH_MOBI_[EG]:               EllrGGdGGErdEdGdalaE                                                                           
RICH_MOBI_[GR]:                                   ReaaGtGwdpGaspRRRGqR                                                       

                                          120        
AA:                      IVIFFWVMLWFLGLQALGLVAVLCLVIIYVQQ
STMI:                    MMMMMMMMMMMMMMMMMMMM            
DO_DISOPRED3:            ................................
DO_IUPRED2A:             ................................
DO_SPOTD:                .............................DDD
CONSENSUS:                                   ............
CONSENSUS_MOBI:                              ............