Q8N907 DAND5_HUMAN

Gene name: DAND5
Protein name: DAN domain family member 5

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y2U2 KCNK7 0.52857 transmembrane transport GO:0055085
transport GO:0006810
2 Q93038 TNFRSF25 0.51873 cell death GO:0008219
signal transduction GO:0007165
3 Q6ZNG2 DBX2 0.50716 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 O95208 EPN2 0.50545 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
membrane organization GO:0061024
...
5 Q9UPG8 PLAGL2 0.50542 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
6 Q93097 WNT2B 0.49507 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
7 P10696 ALPG 0.49104
8 Q8N8Q8 COX18 0.49078 cellular component assembly GO:0022607
membrane organization GO:0061024
protein transport GO:0015031
...
9 Q16587 ZNF74 0.49026 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q8WX92 NELFB 0.48194 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGM
STMI:                    SSSSSSSSSSSSSSSSSSSSSS                                                                              
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
DO_IUPRED2A:             ...................DDDDDDDDDDDDDDDDD................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
CONSENSUS:                                     DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
CONSENSUS_MOBI:                                ..............................................................................
RICH_[PW]:                                      PePqsPrPqsWaaanqtW                                                           
RICH_[QW]:                                         QsprpQsWaaanQtW                                                           
RICH_[AL]:                                                        ALgpgALppLvpAsALgswkA                                      
RICH_[AP]:                                      PePqsPrPqswAAAnqtwA                                                          
RICH_[AW]:                                                WAAAnqtWAlgpgA                                                     
RICH_[A]:                                                  AAAnqtwAlgpgAlpplvpA                                              
RICH_[Q]:                                                                                  QkarQlgmgrlQrgQ                   
RICH_[GL]:                                                                       LGswkafLGLqkarqLGmGrL                       
RICH_[GQ]:                                                                               GlQkarQlGmGrlQrGQ                   
RICH_[LP]:                                                         LgPgaLPPLvPasaL                                           
RICH_[LQ]:                                                                              LgLQkarQLgmgrLQrgQ                   
RICH_[LW]:                                                       WaLgpgaLppLvpasaLgsW                                        

                                          120                 140                 160                 180           
AA:                      CKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
STMI:                                                                                                             
DO_DISOPRED3:            .........................................................................................
DO_IUPRED2A:             .........................................................................................
DO_SPOTD:                .........................................................................................
CONSENSUS:               .........................................................................................
CONSENSUS_MOBI:          .........................................................................................