Q8N9R0 CP081_HUMAN

Gene name: LINC00304
Protein name: Putative uncharacterized protein encoded by LINC00304

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BQ13 KCTD14 0.84045 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 Q13275 SEMA3F 0.82893 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
3 Q2PZI1 DPY19L1 0.81138 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
4 Q15560 TCEA2 0.79844 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q04912 MST1R 0.79646 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
6 Q6UY14 ADAMTSL4 0.78688 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
7 P51512 MMP16 0.77638 anatomical structure development GO:0048856
catabolic process GO:0009056
cell population proliferation GO:0008283
...
8 Q96MX3 ZNF48 0.7757
9 Q9BWN1 PRR14 0.77519 anatomical structure development GO:0048856
10 A1X283 SH3PXD2B 0.77504 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MQYLHCCLQIAPNQEGMVQAGGQGHGLARVVLRAVLSPPCWAPHSPCGSPAATEAGRLMRRLPSVGGRMTAPKTPRFLTRRPPASSPEDPPLPHPKTPRF
STMI:                                                                                                                        
DO_DISOPRED3:            .........................................................................DDDDD..DDDDDDD.............
DO_IUPRED2A:             ..............DDDDDDDDDDD...D................DDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                                                             PsvggRmtaPktPRfltRRPPassP             
RICH_[P]:                                                                                       PktPrfltrrPPassPedPPlPhPktPrf
RICH_[R]:                                                                        RlmRRlpsvggRmtapktpRfltRR                   
RICH_fLPS_[P]:                                                                                         trrPPassPedPPlPhPktP  
RICH_MOBI_[PR]:                                                                                                      PhPktPRf
RICH_MOBI_[P]:                                                                                  PktPrfltrrPPassPedPPlPhPktPrf
RICH_MOBI_[R]:                                                                              RmtapktpRfltRR                 Rf
RICH_MOBI_[FL]:                                                                                                             F
RICH_MOBI_[FR]:                                                                                                            RF
RICH_MOBI_[LR]:                                                                                                            Rf

                                          120                 140               
AA:                      LTQRPPASLPRRPRFLTLGPVSSHSSGDLRLWTAHQLPQQGGCPG
STMI:                                                                 
DO_DISOPRED3:            ........................................DDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDD............................DDDDDDD
CONSENSUS:               DDDDDDDDDD............................DDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                ltqrPPaslP                                   
RICH_MOBI_[PR]:          ltqRPPaslPRRPR                               
RICH_MOBI_[L]:           LtqrppasLprrprfLtL                           
RICH_MOBI_[P]:           ltqrPPaslPrrP                                
RICH_MOBI_[R]:           ltqRppaslpRRpR                               
RICH_MOBI_[FL]:          LtqrppasLprrprFLtL                           
RICH_MOBI_[FR]:          ltqRppaslpRRpRF                              
RICH_MOBI_[GQ]:                                             QlpQQGGcpG
RICH_MOBI_[HL]:                                 HssgdLrLwtaHqL        
RICH_MOBI_[LQ]:                                      LrLwtahQLpQQ     
RICH_MOBI_[LR]:          LtqRppasLpRRpRfLtL