Q8N9R6 CDRT4_HUMAN

Gene name: CDRT4
Protein name: CMT1A duplicated region transcript 4 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q14722 KCNAB1 0.86429 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
...
2 P11717 IGF2R 0.79429 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
...
3 P29084 GTF2E2 0.76178 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 P12757 SKIL 0.74054 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 Q5M9Q1 NKAPL 0.72484 cell differentiation GO:0030154
reproduction GO:0000003
6 O60861 GAS7 0.7188 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
7 Q70CQ4 USP31 0.71877 catabolic process GO:0009056
cellular protein modification process GO:0006464
8 Q69YN2 CWF19L1 0.71661 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
9 Q53EZ4 CEP55 0.7119 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
10 Q96N46 TTC14 0.7009

                                           20                  40                  60                  80                 100
AA:                      MDARRMKKEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSM
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.D.................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDD........................D.....D....DDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD..........
DO_SPOTD:                DDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDD.....................................D....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
RICH_[K]:                                                                                   KpssviqpKrrKssKssgK              
RICH_[R]:                                                                           RpwasRqnkpssviqpkRR                      
RICH_[S]:                                                                               SrqnkpSSviqpkrrkSSkSS                
RICH_[KS]:                                                                              SrqnKpSSviqpKrrKSSKSSgK              
RICH_MOBI_[K]:                                                                              KpssviqpKrrKssKssgK              
RICH_MOBI_[L]:                     LtentgLprkLL                                                                              
RICH_MOBI_[R]:                                                                      RpwasRqnkpssviqpkRR                      
RICH_MOBI_[S]:                                                                                SSviqpkrrkSSkSS                
RICH_MOBI_[KS]:                                                                         SrqnKpSSviqpKrrKSSKSSgK              

                                          120                 140         
AA:                      WGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY
STMI:                                                                       
DO_DISOPRED3:            ...............D...................................
DO_IUPRED2A:             ..............DDDDDDDDDDDD.........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDD.
CONSENSUS:               ..............DDDDDDDDDDDD.........................
CONSENSUS_MOBI:          ...................................................