Q8NA77 TEX19_HUMAN
Gene name: TEX19
Protein name: Testis-expressed protein 19
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P0C7M4 | RHOXF2B | 0.70543 | |
| 2 | Q86TD4 | SRL | 0.69012 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | Q9BQY4 | RHOXF2 | 0.68788 | |
| 4 | Q96A49 | SYAP1 | 0.6533 | cell differentiation GO:0030154 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 5 | Q0VD83 | APOBR | 0.65066 | small molecule metabolic process GO:0044281 transport GO:0006810 |
| 6 | P48681 | NES | 0.63537 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 7 | Q9HBQ8 | GOLGA2P5 | 0.63242 | |
| 8 | Q6ZNH5 | ZNF497 | 0.62916 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q562E7 | WDR81 | 0.62742 | catabolic process GO:0009056 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 10 | A0A0J9YX94 | PNMA6F | 0.62579 |
20 40 60 80 100 AA: MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGP STMI: DO_DISOPRED3: D.............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD DO_IUPRED2A: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[AG]: GqpvqGGseAwGp RICH_[A]: Awgp RICH_[E]: EEdnwdpElmEhtEaEsEqEgssgmE RICH_[G]: GssGmelswGqspGqpvqGGseawGp RICH_[Q]: QegssgmelswgQspgQpvQ RICH_[W]: WgqspgqpvqggseaW RICH_[EG]: EsEqEGssGmElswGqspG RICH_[GQ]: QeGssGmelswGQspGQpvQGG RICH_[GW]: WGqspGqpvqGGseaWGp RICH_fLPS_[E]: EEdnwdpElmEhtEaEsEqE RICH_MOBI_[AG]: GqpvqGGseAwGp RICH_MOBI_[A]: Awgp RICH_MOBI_[E]: EdnwdpElmEhtEaEsEqEgssgmE RICH_MOBI_[G]: GssGmelswGqspGqpvqGGseawGp RICH_MOBI_[Q]: QegssgmelswgQspgQpvQ RICH_MOBI_[W]: WgqspgqpvqggseaW RICH_MOBI_[EG]: EsEqEGssGmElswGqspG RICH_MOBI_[EM]: ElMEhtEaEsEqEgssgME RICH_MOBI_[GQ]: QeGssGmelswGQspGQpvQGG RICH_MOBI_[GW]: WGqspGqpvqGGseaWGp RICH_fLPS_MOBI_[E]: EhtEaEsEqE
120 140 160 AA: GTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSHWPSFFPS STMI: DO_DISOPRED3: DDDDDDDDD.DD..................................................DD DO_IUPRED2A: DDDDDDDDDDDDDD.DDDD.D........DD....D............................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDD..........................................DD CONSENSUS: DDDDDDDDDDDDDDDDDDD...........................................DD CONSENSUS_MOBI: DDDDDDDDDDDD.................................................... RICH_[AG]: GtlAAApeGledAG RICH_[A]: gtlAAA RICH_[G]: G RICH_[GW]: G RICH_MOBI_[AG]: GtlAAApeG RICH_MOBI_[A]: gtlAAA RICH_MOBI_[G]: G RICH_MOBI_[GW]: G