Q8NEJ0 DUS18_HUMAN
Gene name: DUSP18
Protein name: Dual specificity protein phosphatase 18
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99436 | PSMB7 | 0.65828 | |
| 2 | Q9UNQ0 | ABCG2 | 0.42874 | cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 3 | Q9Y679 | AUP1 | 0.3289 | catabolic process GO:0009056 protein transport GO:0015031 response to stress GO:0006950 ... |
| 4 | Q86SJ2 | AMIGO2 | 0.30392 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 5 | Q8N5N7 | MRPL50 | 0.23331 | |
| 6 | P98161 | PKD1 | 0.22638 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q9UJX4 | ANAPC5 | 0.21875 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 8 | O15127 | SCAMP2 | 0.21119 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q9BZJ0 | CRNKL1 | 0.20723 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 10 | Q9H0A9 | SPATC1L | 0.19414 | cellular protein modification process GO:0006464 cytoskeleton organization GO:0007010 reproduction GO:0000003 ... |
20 40 60 80 100 AA: MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD................................................................................... RICH_MOBI_[FV]: FpVqFrqpsV
120 140 160 180 AA: LLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL STMI: DO_DISOPRED3: ........................................................................................ DO_IUPRED2A: ........................................................................................ DO_SPOTD: .................................................................................DDDDDDD CONSENSUS: ........................................................................................ CONSENSUS_MOBI: ...............................................................................DDDDDDDDD