Q8NHE4 VA0E2_HUMAN

Gene name: ATP6V0E2
Protein name: V-type proton ATPase subunit e 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                   
AA:                      MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE
STMI:                           MMMMMMMMMMMMMMMMMMMMM       MMMMMMMMMMMMMMMMMMMMM                         
DO_DISOPRED3:            DDDDDD.D.........................................................................
DO_IUPRED2A:             .................................................................................
DO_SPOTD:                DDDDD............................................................................
CONSENSUS:               DDDDD..                     .......                     .........................
CONSENSUS_MOBI:          .......                     .......                     .........................