Q8TAP9 MPLKI_HUMAN

Gene name: MPLKIP
Protein name: M-phase-specific PLK1-interacting protein

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P20073 ANXA7 0.79907 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
2 Q9UBV8 PEF1 0.75466 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 Q92945 KHSRP 0.71856 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
4 O95429 BAG4 0.7105 cell adhesion GO:0007155
cell death GO:0008219
cellular component assembly GO:0022607
...
5 P53992 SEC24C 0.66238 cellular component assembly GO:0022607
immune system process GO:0002376
membrane organization GO:0061024
...
6 P17275 JUNB 0.66201 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 O14497 ARID1A 0.65752 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q8ND25 ZNRF1 0.64874 catabolic process GO:0009056
cellular protein modification process GO:0006464
9 Q96EP5 DAZAP1 0.64768 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
10 P14866 HNRNPL 0.64006 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...

                                           20                  40                  60                  80                 100
AA:                      MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PS]:                                                                                              SPSPggyPgSySrSPagS   
RICH_[PY]:                                                  PrPPsPrdgYgsPhhtPPYgPrsrPYgsshsP      PggrfgsPsPggYPgsYsrsP      
RICH_[QY]:                                                                                                    YpgsYsrspagsQQQ
RICH_[G]:                              GpGGGGwGsGssfrGtpGGGGprppsprdGyG               GsshsprhGGsfpGGrfG                     
RICH_[P]:                                              PggggPrPPsPrdgygsP                                                    
RICH_[Q]:                                                                                                                 QQQ
RICH_[S]:                                                                              SShSprhggSfpggrfgSpS                  
RICH_[Y]:                                                            YgsphhtppY                                              
RICH_[SY]:                                                                                              SpSpggYpgSYSrSpagS   
RICH_[FG]:                                                                                    GGsFpGGrFGspspGG               
RICH_[GH]:                                                                            GssHsprHGGsfpGG                        
RICH_[GP]:                      PPtPPyPGPGGGGwGsGssfrGtPGGGGPrPPsPrdGyGsPhhtPP  PrsrPyGsshsPrhGGsfPG   GsPsPGGyPGsysrsPaG    
RICH_[GQ]:                                                                                                      GsysrspaGsQQQ
RICH_[GS]:                                                                             SShSprhGGSfpGGrfGSpS                  
RICH_[GY]:                                                          GYGsphhtppYGprsrpYG        GsfpGGrfGspspGGYpGsYsrspaGsqqq
RICH_[HP]:                                                  PrPPsPrdgygsPHH                                                  
RICH_[HS]:                                                                             SSHSprHggS                            
RICH_[HY]:                                                           YgspHHtppY                                              
RICH_fLPS_[P]:                 rPPtPPyPgP                                                                                    
RICH_fLPS_[Q]:                                                                                                        pagsQQQ
RICH_fLPS_[G]:                         GpGGGGwGsGssfrGtpGGGG                                 hGGsfpGGrfGspspGGypG            
RICH_MOBI_[PY]:                                             PrPPsPrdgYgsPhhtPPYgPrsrPY                                       
RICH_MOBI_[QY]:                                                                                               YpgsYsrspagsQQQ
RICH_MOBI_[G]:                         GpGGGGwGsGssfrGtpGGGGprppsprdGyG               GsshsprhGGsfpGGrfG                     
RICH_MOBI_[P]:                                         PggggPrPPsPrdgygsP                                                    
RICH_MOBI_[Q]:                                                                                                            QQQ
RICH_MOBI_[Y]:                                                       YgsphhtppY                                              
RICH_MOBI_[SY]:                                                                                         SpSpggYpgSYSrSpagS   
RICH_MOBI_[FG]:                                                                       GsshsprhGGsFpGGrFGspspGGypG            
RICH_MOBI_[FS]:                                                                        SShSprhggSFpggrFgSpS                  
RICH_MOBI_[FY]:                                                                                  FpggrFgspspggYpgsY          
RICH_MOBI_[GH]:                                                                       GssHsprHGGsfpGG                        
RICH_MOBI_[GP]:                 PPtPPyPGPGGGGwGsG    GtPGGGGPrPPsPrdGyGsP                                                    
RICH_MOBI_[GQ]:                                                                                                 GsysrspaGsQQQ
RICH_MOBI_[GS]:                                                                        SShSprhGGSfpGGrfGSpS                  
RICH_MOBI_[GY]:                                                     GYGsphhtppYGprsrpYG        GsfpGGrfGspspGGYpGsYsrspaGsqqq
RICH_MOBI_[HS]:                                                                        SSHSprHggS                            
RICH_MOBI_[HY]:                                                      YgspHHtppY                                              
RICH_fLPS_MOBI_[P]:            rPPtPPyPgP                                                                                    
RICH_fLPS_MOBI_[Q]:                                                                                                   pagsQQQ
RICH_fLPS_MOBI_[G]:                    GpGGGGwGsGssfrGtpGGGG                                 hGGsfpGGrfGspspGGypG            
RICH_fLPS_MOBI_[QY]:                                                                                          YpgsYsrspagsQQQ
RICH_fLPS_MOBI_[Y]:                                               rdgYgsphhtppYgprsrpY                      ggYpgsYsrspagsqqq

                                          120                 140                 160 
AA:                      FGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
STMI:                                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD......DDD..DDDDDDDDDDDD............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
RICH_[PQ]:                   PgQQQthPQgsPrtstP                                                          
RICH_[QT]:                                                                            QQysnTQTfT        
RICH_[QV]:                                                                     VsVVdisQQysntQ           
RICH_[QY]:               fgYspgQQQ                                                                      
RICH_[Q]:                fgyspgQQQthpQ                                                                  
RICH_[R]:                                RtstpfgsgRvRekR                                                
RICH_[EN]:                                           EkrmsNElEN                                         
RICH_[GQ]:               fGyspGQ                                                                        
RICH_[GY]:               fGY                                                                            
RICH_fLPS_[Q]:           fgyspgQQQthpQ                                                                  
RICH_MOBI_[QY]:          fgYspgQQQ                                                                      
RICH_MOBI_[Q]:           fgyspgQQQthpQ                                                                  
RICH_MOBI_[R]:                           RtstpfgsgRvRekR                                                
RICH_MOBI_[GQ]:          fGyspGQ                                                                        
RICH_MOBI_[GY]:          fGY                                                                            
RICH_fLPS_MOBI_[Q]:      fgyspgQQQthpQ                                                                  
RICH_fLPS_MOBI_[QY]:     fgYspgQQQ                                                                      
RICH_fLPS_MOBI_[Y]:      fgY