Q8TCZ7 CU074_HUMAN
Gene name: LINC00308
Protein name: Putative uncharacterized protein encoded by LINC00308
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MAYVFNLSCLGSQVERLLEARSSRPTWIIQPSPKKAPEACFSFHSSYERNWA STMI: DO_DISOPRED3: D................................................... DO_IUPRED2A: .................................................... DO_SPOTD: ............................................DDDDDDDD CONSENSUS: .................................................... CONSENSUS_MOBI: ....................................................