Q8WU68 U2AF4_HUMAN
Gene name: U2AF1L4
Protein name: Splicing factor U2AF 26 kDa subunit
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8WYQ4 | C22orf15 | 0.65191 | |
| 2 | Q96GM1 | PLPPR2 | 0.62241 | signal transduction GO:0007165 |
| 3 | Q6U841 | SLC4A10 | 0.62212 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 4 | Q2Y0W8 | SLC4A8 | 0.58881 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 5 | Q92901 | RPL3L | 0.57785 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q8TAD8 | SNIP1 | 0.57275 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 7 | Q3B7T3 | BEAN1 | 0.5668 | |
| 8 | Q9UK58 | CCNL1 | 0.56617 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | P04554 | PRM2 | 0.56466 | anatomical structure development GO:0048856 cell differentiation GO:0030154 chromosome organization GO:0051276 ... |
| 10 | Q68DN1 | C2orf16 | 0.56283 |
20 40 60 80 100 AA: MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDVEVQEHYDSFFEEVFTELQEKYGEIEEMN STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ..............................................................D..................................... DO_SPOTD: DDDD...D............................................................................................ CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: VCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISQNLQRQLYGRGPRRRSPPRFHT STMI: DO_DISOPRED3: ........................................................................................DDDDDDDDDDDD DO_IUPRED2A: ..................................................................................DDDDDDDDDDDDDDDDDD DO_SPOTD: ......................................................................................DDDDDDDDDDDDDD CONSENSUS: ......................................................................................DDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................................DDDDDDDDDDDDDDDD RICH_[PR]: RgPRRRsPPRfht RICH_[H]: Ht RICH_[R]: RgpRRRsppRfht RICH_[HP]: PrrrsPPrfHt RICH_[HR]: RgpRRRsppRfHt RICH_fLPS_[R]: RgpRRRsppRfht RICH_fLPS_[H]: fHt RICH_fLPS_[HR]: RgpRRRsppRfHt RICH_MOBI_[H]: Ht RICH_MOBI_[R]: RgpRRRsppRfht RICH_MOBI_[HR]: RgpRRRsppRfHt RICH_fLPS_MOBI_[R]: RgpRRRsppRfht RICH_fLPS_MOBI_[H]: fHt RICH_fLPS_MOBI_[HR]: RgpRRRsppRfHt