Q8WVD5 RN141_HUMAN
Gene name: RNF141
Protein name: RING finger protein 141
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A8MW99 | MEI4 | 0.98343 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 2 | P51677 | CCR3 | 0.81167 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | Q6ZW76 | ANKS3 | 0.79369 | |
| 4 | Q92536 | SLC7A6 | 0.79262 | immune system process GO:0002376 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q9UHX3 | ADGRE2 | 0.79262 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 6 | Q9NUX5 | POT1 | 0.79262 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P52741 | ZNF134 | 0.79241 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | P51955 | NEK2 | 0.75913 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 9 | Q7Z2X4 | PID1 | 0.73372 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 10 | P43361 | MAGEA8 | 0.72128 |
20 40 60 80 100 AA: MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNL STMI: DO_DISOPRED3: DDDDDDDD............................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDD......................................................................................... CONSENSUS: DDDDDDDD............................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: YQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANE STMI: DO_DISOPRED3: ........................DDDDDDDDDD.................................................................. DO_IUPRED2A: .................DDDDDDDDD.DDDD..................................................................... DO_SPOTD: ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................... CONSENSUS: .................DDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[S]: SStSeepdenSSS RICH_[ES]: SEEpdEnSSS
220 AA: SWVVSDAPTEDDMANYILNMADEAGQPHRP STMI: DO_DISOPRED3: ...............DDDDDDDDDDDDDDD DO_IUPRED2A: .DDDDD.......DDDDDDDDD.DD.DDDD DO_SPOTD: .......................DDDDDDD CONSENSUS: ...............DDDDDDDDDDDDDDD CONSENSUS_MOBI: ..............................