Q8WVI0 SMIM4_HUMAN

Gene name: SMIM4
Protein name: Small integral membrane protein 4

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60          
AA:                      MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE
STMI:                                       MMMMMMMMMMMMMMMMMMMMMM                             
DO_DISOPRED3:            DDDD................................................................DD
DO_IUPRED2A:             ......................................................................
DO_SPOTD:                D..........................................................DDDDDDDDDDD
CONSENSUS:               D..................                      ...........................DD
CONSENSUS_MOBI:          ...................                      .............................