Q8WVL7 ANR49_HUMAN
Gene name: ANKRD49
Protein name: Ankyrin repeat domain-containing protein 49
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P48048 | KCNJ1 | 0.83205 | transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q969Q6 | PPP2R3C | 0.70711 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 3 | Q9H2H9 | SLC38A1 | 0.58096 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | Q8TAF7 | ZNF461 | 0.52523 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q9Y473 | ZNF175 | 0.47034 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 6 | P05093 | CYP17A1 | 0.46176 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 |
| 7 | Q13976 | PRKG1 | 0.44901 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | O94892 | ZNF432 | 0.4055 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q9NPB8 | GPCPD1 | 0.38949 | anatomical structure development GO:0048856 catabolic process GO:0009056 |
| 10 | Q8N5C7 | DTWD1 | 0.38662 | cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATH STMI: DO_DISOPRED3: DDDDDDD............................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD..DDDD.....DDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDD........D....................DDDD DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[DN]: NDDgipDqeN
120 140 160 180 200 AA: VNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: DDDDDDDDDD.D........................................................................................ DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: KPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS STMI: DO_DISOPRED3: ....................................DDD DO_IUPRED2A: ....................................D.D DO_SPOTD: ................................DDDDDDD CONSENSUS: ....................................DDD CONSENSUS_MOBI: .......................................