Q8WW59 SPRY4_HUMAN
Gene name: SPRYD4
Protein name: SPRY domain-containing protein 4
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96EY5 | MVB12A | 0.9968 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 2 | Q8NB49 | ATP11C | 0.99523 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 ... |
| 3 | Q96RP7 | GAL3ST4 | 0.99337 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell-cell signaling GO:0007267 |
| 4 | Q8IYM2 | SLFN12 | 0.98546 | |
| 5 | Q6TFL4 | KLHL24 | 0.96603 | cellular protein modification process GO:0006464 cytoskeleton organization GO:0007010 signal transduction GO:0007165 ... |
| 6 | Q495T6 | MMEL1 | 0.9291 | |
| 7 | Q15349 | RPS6KA2 | 0.90637 | cell cycle GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 8 | P52823 | STC1 | 0.90601 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 9 | Q9BW92 | TARS2 | 0.81697 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 10 | P04628 | WNT1 | 0.81697 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDMGVKYGLVGLEPTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[R]: RslRlcRwgakR RICH_[LR]: LLfaRsLRLcRwgakRL
120 140 160 180 200 AA: RIGVADVDMSRDSCIGVDDRSWVFTYAQRKWYTMLANEKAPVEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDFRGPVVPAFALWDGELLTHSG STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: LEVPEGL STMI: DO_DISOPRED3: ....... DO_IUPRED2A: ....... DO_SPOTD: ....... CONSENSUS: ....... CONSENSUS_MOBI: .......